powered by:
Protein Alignment CG7220 and UBE2L3
DIOPT Version :9
Sequence 1: | NP_001097261.1 |
Gene: | CG7220 / 36129 |
FlyBaseID: | FBgn0033544 |
Length: | 190 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001243284.1 |
Gene: | UBE2L3 / 7332 |
HGNCID: | 12488 |
Length: | 212 |
Species: | Homo sapiens |
Alignment Length: | 136 |
Identity: | 30/136 - (22%) |
Similarity: | 57/136 - (41%) |
Gaps: | 44/136 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 VSKCG----KPLQLDNSR---WERRLHKELMSLIKEPPPGVTIDTESVQQNLSEWKINIKGFEGT 86
:.||| :.:|:|.:. |:. .::.:.||
Human 72 IRKCGMKNFRNIQVDEANLLTWQG-------LIVPDNPP-------------------------- 103
Fly 87 LYEGEDFQLLFKFNNKYPFDSPEVTFIGTNIPVHPHVYSNGHICLSILT-EDWSPALSVQSVCLS 150
|:...|::...|..:|||..|::|| .|.| .||::...|.:||.::: |:|.||.....|..|
Human 104 -YDKGAFRIEINFPAEYPFKPPKITF-KTKI-YHPNIDEKGQVCLPVISAENWKPATKTDQVIQS 165
Fly 151 IASMLS 156
:.::::
Human 166 LIALVN 171
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.