DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7220 and Ube2w

DIOPT Version :9

Sequence 1:NP_001097261.1 Gene:CG7220 / 36129 FlyBaseID:FBgn0033544 Length:190 Species:Drosophila melanogaster
Sequence 2:XP_006495620.1 Gene:Ube2w / 66799 MGIID:1914049 Length:174 Species:Mus musculus


Alignment Length:163 Identity:93/163 - (57%)
Similarity:119/163 - (73%) Gaps:25/163 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KPLQLDNSRW-----------ERRLHKELMSLIKEPPPGVTIDTESVQQNLSEWKINIKGFEGTL 87
            :||:| ..||           ::||.|||::|..:||||:|::.:|||.::::|.::::|..|||
Mouse    14 RPLRL-GPRWPWGDGFIMASMQKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTL 77

  Fly    88 YEGEDFQLLFKFNNKYPFDSPEVTFIGTNIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIA 152
            ||||.|||||||:::||||||:|.|.|.|||:||||||||||||||||||||||||||||||||.
Mouse    78 YEGEKFQLLFKFSSRYPFDSPQVMFTGENIPIHPHVYSNGHICLSILTEDWSPALSVQSVCLSII 142

  Fly   153 SMLSSCREK--------KRPPDNTIYVKTCNKN 177
            ||||||:||        |||.:     |.|..|
Mouse   143 SMLSSCKEKILSLMEVGKRPDE-----KWCELN 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7220NP_001097261.1 UQ_con 46..187 CDD:278603 88/140 (63%)
Ube2wXP_006495620.1 UQ_con 36..>148 CDD:365926 78/111 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167832973
Domainoid 1 1.000 219 1.000 Domainoid score I2637
eggNOG 1 0.900 - - E2759_KOG0427
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10119
Inparanoid 1 1.050 244 1.000 Inparanoid score I3274
Isobase 1 0.950 - 0 Normalized mean entropy S752
OMA 1 1.010 - - QHG55135
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002332
OrthoInspector 1 1.000 - - oto93256
orthoMCL 1 0.900 - - OOG6_102995
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4436
SonicParanoid 1 1.000 - - X1538
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1716.740

Return to query results.
Submit another query.