DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7220 and ube2wa

DIOPT Version :9

Sequence 1:NP_001097261.1 Gene:CG7220 / 36129 FlyBaseID:FBgn0033544 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001116444.1 Gene:ube2wa / 553013 ZFINID:ZDB-GENE-050506-94 Length:151 Species:Danio rerio


Alignment Length:146 Identity:106/146 - (72%)
Similarity:130/146 - (89%) Gaps:0/146 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 ERRLHKELMSLIKEPPPGVTIDTESVQQNLSEWKINIKGFEGTLYEGEDFQLLFKFNNKYPFDSP 108
            ::||.|||::|..:||.|:|::..|||..::||.|:::|.:||:||||.|||||||:::|||:||
Zfish     5 QKRLQKELLALQNDPPAGMTLNERSVQNTITEWFIDMEGAQGTVYEGEKFQLLFKFSSRYPFESP 69

  Fly   109 EVTFIGTNIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIASMLSSCREKKRPPDNTIYVKT 173
            :|.|.|.||||||||||||||||||||||||||||||||||||.||||||:||:|||||:.||||
Zfish    70 QVMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVKT 134

  Fly   174 CNKNPKKTKWWYHDDS 189
            |||||||||||||||:
Zfish   135 CNKNPKKTKWWYHDDT 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7220NP_001097261.1 UQ_con 46..187 CDD:278603 103/140 (74%)
ube2waNP_001116444.1 UQ_con 7..148 CDD:278603 103/140 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575684
Domainoid 1 1.000 218 1.000 Domainoid score I2596
eggNOG 1 0.900 - - E2759_KOG0427
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 245 1.000 Inparanoid score I3268
OMA 1 1.010 - - QHG55135
OrthoDB 1 1.010 - - D1522577at2759
OrthoFinder 1 1.000 - - FOG0002332
OrthoInspector 1 1.000 - - otm26505
orthoMCL 1 0.900 - - OOG6_102995
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4436
SonicParanoid 1 1.000 - - X1538
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.