DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7220 and UBE2W

DIOPT Version :9

Sequence 1:NP_001097261.1 Gene:CG7220 / 36129 FlyBaseID:FBgn0033544 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001001481.3 Gene:UBE2W / 55284 HGNCID:25616 Length:162 Species:Homo sapiens


Alignment Length:145 Identity:106/145 - (73%)
Similarity:131/145 - (90%) Gaps:0/145 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RRLHKELMSLIKEPPPGVTIDTESVQQNLSEWKINIKGFEGTLYEGEDFQLLFKFNNKYPFDSPE 109
            :||.|||::|..:||||:|::.:|||.::::|.::::|..|||||||.|||||||:::||||||:
Human    17 KRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQ 81

  Fly   110 VTFIGTNIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIASMLSSCREKKRPPDNTIYVKTC 174
            |.|.|.||||||||||||||||||||||||||||||||||||.||||||:||:|||||:.||:||
Human    82 VMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTC 146

  Fly   175 NKNPKKTKWWYHDDS 189
            ||||||||||||||:
Human   147 NKNPKKTKWWYHDDT 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7220NP_001097261.1 UQ_con 46..187 CDD:278603 103/140 (74%)
UBE2WNP_001001481.3 UQ_con 18..159 CDD:395127 103/140 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142849
Domainoid 1 1.000 219 1.000 Domainoid score I2654
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10119
Inparanoid 1 1.050 246 1.000 Inparanoid score I3286
Isobase 1 0.950 - 0 Normalized mean entropy S752
OMA 1 1.010 - - QHG55135
OrthoDB 1 1.010 - - D1522577at2759
OrthoFinder 1 1.000 - - FOG0002332
OrthoInspector 1 1.000 - - oto89688
orthoMCL 1 0.900 - - OOG6_102995
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4436
SonicParanoid 1 1.000 - - X1538
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1514.890

Return to query results.
Submit another query.