DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7220 and ube2w

DIOPT Version :9

Sequence 1:NP_001097261.1 Gene:CG7220 / 36129 FlyBaseID:FBgn0033544 Length:190 Species:Drosophila melanogaster
Sequence 2:XP_012820132.1 Gene:ube2w / 548886 XenbaseID:XB-GENE-954746 Length:156 Species:Xenopus tropicalis


Alignment Length:147 Identity:108/147 - (73%)
Similarity:132/147 - (89%) Gaps:1/147 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 WERRLHKELMSLIKEPPPGVTIDTESVQQNLSEWKINIKGFEGTLYEGEDFQLLFKFNNKYPFDS 107
            | :||.|||::|..|||||:|::.:|||.::::|.::::|..|||||||.|||||||:::|||||
 Frog    10 W-KRLQKELLALQNEPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDS 73

  Fly   108 PEVTFIGTNIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIASMLSSCREKKRPPDNTIYVK 172
            |:|.|.|.||||||||||||||||||||||||||||||||||||.||||||:||:|||||:.||:
 Frog    74 PQVMFTGDNIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVR 138

  Fly   173 TCNKNPKKTKWWYHDDS 189
            ||||||||||||||||:
 Frog   139 TCNKNPKKTKWWYHDDT 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7220NP_001097261.1 UQ_con 46..187 CDD:278603 104/140 (74%)
ube2wXP_012820132.1 UQ_con 12..153 CDD:365926 104/140 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 220 1.000 Domainoid score I2574
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10119
Inparanoid 1 1.050 247 1.000 Inparanoid score I3190
OMA 1 1.010 - - QHG55135
OrthoDB 1 1.010 - - D1522577at2759
OrthoFinder 1 1.000 - - FOG0002332
OrthoInspector 1 1.000 - - otm48368
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4436
SonicParanoid 1 1.000 - - X1538
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.