DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7220 and ube2z

DIOPT Version :9

Sequence 1:NP_001097261.1 Gene:CG7220 / 36129 FlyBaseID:FBgn0033544 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001007969.2 Gene:ube2z / 493338 XenbaseID:XB-GENE-990986 Length:313 Species:Xenopus tropicalis


Alignment Length:161 Identity:49/161 - (30%)
Similarity:75/161 - (46%) Gaps:38/161 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DNSRWER----RLHKELMSLIKEPPPGVTIDTESVQQNLSEWKINIKGFEGTLYEGEDFQLLFKF 99
            ||.|...    |:.:::||:.||||||:.:..:  ..::::....|.|...|.|||..|..||:.
 Frog    51 DNERASNQCVLRIKRDIMSIYKEPPPGMFVVPD--PHDMTKIHALITGPFDTPYEGGFFLFLFRC 113

  Fly   100 NNKYPFDSPEVTFIGT---NIPVHPHVYSNGHICLSIL----TEDWSPALSVQSVCLSIASMLSS 157
            ...||...|.|..:.|   .:..:|:.|.||.:|||||    ...||||.|:.||.:||.|::: 
 Frog   114 PPDYPIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSLSSVLISIQSLMT- 177

  Fly   158 CREKKRPPDNTIYVKTCNKNPKKTKWWYHDD 188
                              :||      ||::
 Frog   178 ------------------ENP------YHNE 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7220NP_001097261.1 UQ_con 46..187 CDD:278603 45/147 (31%)
ube2zNP_001007969.2 UBCc 62..207 CDD:238117 46/150 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 283..313
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.