DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7220 and CG46338

DIOPT Version :9

Sequence 1:NP_001097261.1 Gene:CG7220 / 36129 FlyBaseID:FBgn0033544 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_524888.1 Gene:CG46338 / 47272 FlyBaseID:FBgn0285962 Length:244 Species:Drosophila melanogaster


Alignment Length:137 Identity:27/137 - (19%)
Similarity:49/137 - (35%) Gaps:35/137 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 NLSEWKINIKGFEGTLYEGEDFQLLFKFNNKYPFDSPEVTFIGTNIPVHPHVYSNGH-ICLSILT 135
            |..:|.....|.:| ||....|:......:::|.|....:.|.....:||||....| :.:|...
  Fly    48 NSLQWFGVFFGRQG-LYAESVFRFTILLPDRFPDDKSLPSIIFQQDVIHPHVCPYTHSLDVSHAF 111

  Fly   136 EDW-------------------SPALSVQSVCL------SIASMLSSCREKKRPPDNTIYVKTCN 175
            .:|                   .|..|::.:.:      ..|.:|.:.:|:        ||....
  Fly   112 PEWRCGEDHLWQLLKYLQVIFSDPLDSIRGIEVDKLKNSEAAELLMNNKEE--------YVARVQ 168

  Fly   176 KNPKKTK 182
            :|.|::|
  Fly   169 ENIKESK 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7220NP_001097261.1 UQ_con 46..187 CDD:278603 27/137 (20%)
CG46338NP_524888.1 UBCc 19..169 CDD:294101 24/129 (19%)
COG5078 24..176 CDD:227410 27/137 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438156
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.