DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7220 and ube2q2

DIOPT Version :9

Sequence 1:NP_001097261.1 Gene:CG7220 / 36129 FlyBaseID:FBgn0033544 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001006696.1 Gene:ube2q2 / 448322 XenbaseID:XB-GENE-5858741 Length:368 Species:Xenopus tropicalis


Alignment Length:130 Identity:38/130 - (29%)
Similarity:55/130 - (42%) Gaps:27/130 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RLHKELMSLIKEPPPGVTI-DTESVQQNLSEWKIN----------------IKGFEGTLYEGEDF 93
            ||.|||..:.:.......| ..|.|..:|.||.:.                :|..||.    |..
 Frog   201 RLMKELRDIYRSQSYKTGIYSVELVNDSLYEWHVKLLKVDPDSPLHSDLLVLKEKEGV----ECI 261

  Fly    94 QLLFKFNNKYPFDSPEVTFIGTNIPV--HPHVYSNGHICLSILT-EDWSPALSVQSVCLSIASML 155
            .|.|.|.:.:|||.|   |:....||  ..:|...|.:|:.:|| :.||.|.|::||.:.|.:.|
 Frog   262 LLNFSFKDNFPFDPP---FVRVVSPVLSGGYVLGGGALCMELLTKQGWSSAYSIESVIMQINATL 323

  Fly   156  155
             Frog   324  323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7220NP_001097261.1 UQ_con 46..187 CDD:278603 38/130 (29%)
ube2q2NP_001006696.1 RWD 9..106 CDD:383087
UBCc 199..355 CDD:238117 38/130 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.