DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7220 and vih

DIOPT Version :9

Sequence 1:NP_001097261.1 Gene:CG7220 / 36129 FlyBaseID:FBgn0033544 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_648582.1 Gene:vih / 44118 FlyBaseID:FBgn0264848 Length:178 Species:Drosophila melanogaster


Alignment Length:129 Identity:45/129 - (34%)
Similarity:69/129 - (53%) Gaps:11/129 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DNSRWERRLHKELMSLIKEPPPGVTIDTESVQQNLSEWKINIKGFEGTLYEGEDFQLLFKFNNKY 103
            ||....:|||||||:|:.....|::...:.  :|:.:|...|.|...|:|.|:.::|...|.|.|
  Fly    29 DNHAVSKRLHKELMNLMMANERGISAFPDG--ENIFKWVGTIAGPRNTVYSGQTYRLSLDFPNSY 91

  Fly   104 PFDSPEVTFIGTNIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIASMLSSCREKKRPPDN 167
            |:.:|.|.|:.:..  ||:|...|.|||.||.:.||....|:::.|||.|:|..       |:|
  Fly    92 PYAAPVVKFLTSCF--HPNVDLQGAICLDILKDKWSALYDVRTILLSIQSLLGE-------PNN 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7220NP_001097261.1 UQ_con 46..187 CDD:278603 43/122 (35%)
vihNP_648582.1 COG5078 31..166 CDD:227410 43/127 (34%)
UQ_con 36..172 CDD:278603 43/122 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438033
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.