DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7220 and Ubc7

DIOPT Version :9

Sequence 1:NP_001097261.1 Gene:CG7220 / 36129 FlyBaseID:FBgn0033544 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001285334.1 Gene:Ubc7 / 44054 FlyBaseID:FBgn0267384 Length:167 Species:Drosophila melanogaster


Alignment Length:125 Identity:44/125 - (35%)
Similarity:62/125 - (49%) Gaps:16/125 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RRLHKELMSLIKEPPPGVTIDTESVQQNLSEWKINIKGFEGTLYEGEDFQLLFKFNNKYPFDSPE 109
            |||..|...|..:||.|:.....| :.|..||:..|.|.|||.:||..|.....|...||...|:
  Fly     7 RRLMAEYKQLTLDPPEGIVAGPIS-EDNFFEWEALIAGPEGTCFEGGVFPARLIFPTDYPLSPPK 70

  Fly   110 VTFIGTNIPVHPHVYSNGHICLSIL-------------TEDWSPALSVQSVCLSIASMLS 156
            :.|  |....||:::::|.:|:|||             .|.|||..||:.:.||:.|||:
  Fly    71 MKF--TCDMFHPNIFADGRVCISILHAPGDDPMGYELSAERWSPVQSVEKILLSVVSMLA 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7220NP_001097261.1 UQ_con 46..187 CDD:278603 43/124 (35%)
Ubc7NP_001285334.1 COG5078 1..163 CDD:227410 44/125 (35%)
UQ_con 8..159 CDD:278603 43/124 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438147
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.