DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7220 and CG10254

DIOPT Version :9

Sequence 1:NP_001097261.1 Gene:CG7220 / 36129 FlyBaseID:FBgn0033544 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_651170.1 Gene:CG10254 / 42793 FlyBaseID:FBgn0027512 Length:1398 Species:Drosophila melanogaster


Alignment Length:156 Identity:35/156 - (22%)
Similarity:68/156 - (43%) Gaps:26/156 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PKTPPVSK-CGKPL---------------QLDNSRWERRLHKELMSLIKEPPPGVTIDTESVQQN 72
            |.||.|.: |.:.|               ..:.::::|.:.:|.:.|....|.||.:  .:.:..
  Fly  1087 PDTPSVDENCFQVLPNAPAAHNFISNLITPANKAQYQRAVQREYLMLKSSLPNGVVV--RAYEDR 1149

  Fly    73 LSEWKINIKGFEGTLYEGEDFQLLFKFNNKYPFDSPEVTFIG-TNIPVHPHVYSNGHICLSIL-- 134
            :....:.:.|.:.|.|:...|...|:|...||...|...:|. ....::|::|..|.:|:|:|  
  Fly  1150 MDLMSVMMVGPKRTPYQNALFFFDFQFGRDYPKSPPVCHYISYCTDRLNPNLYEGGRVCVSLLGT 1214

  Fly   135 -----TEDWSPALSVQSVCLSIASML 155
                 .|.|||:.::..|.:||..::
  Fly  1215 WMGRDNEVWSPSSTMLQVLVSIQGLI 1240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7220NP_001097261.1 UQ_con 46..187 CDD:278603 28/118 (24%)
CG10254NP_651170.1 UQ_con 1126..1272 CDD:278603 28/117 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.