DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7220 and CG5823

DIOPT Version :9

Sequence 1:NP_001097261.1 Gene:CG7220 / 36129 FlyBaseID:FBgn0033544 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001262669.1 Gene:CG5823 / 42105 FlyBaseID:FBgn0038515 Length:283 Species:Drosophila melanogaster


Alignment Length:116 Identity:32/116 - (27%)
Similarity:54/116 - (46%) Gaps:10/116 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RLHKELMSLIKEPPPGVTIDTESVQQNLSEWKINIKGFEGTLYEGEDFQLLFKFNNKYPFDSPEV 110
            |:.::.|.|.::|.|.:|  .|.:..|:.||...:||.|.:.|.|..:.....|..::||..|.:
  Fly    18 RMKQDYMRLKRDPLPYIT--AEPLPNNILEWHYCVKGPEDSPYYGGYYHGTLLFPREFPFKPPSI 80

  Fly   111 TFIGTNIPVHPHVYSNGHICLSIL---TEDWSPALSVQSVCLSIAS-MLSS 157
            ..:..|    ....:|..:||||.   .:.|:|...|.::...:.| ||.|
  Fly    81 YMLTPN----GRFKTNTRLCLSISDFHPDTWNPTWCVGTILTGLLSFMLES 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7220NP_001097261.1 UQ_con 46..187 CDD:278603 32/116 (28%)
CG5823NP_001262669.1 UBCc 16..129 CDD:238117 32/116 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438178
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.