DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7220 and Ubc4

DIOPT Version :9

Sequence 1:NP_001097261.1 Gene:CG7220 / 36129 FlyBaseID:FBgn0033544 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001287013.1 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster


Alignment Length:126 Identity:45/126 - (35%)
Similarity:69/126 - (54%) Gaps:6/126 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RRLHKELMSLIKEPPPGVTIDTESVQQNLSEWKINIKGFEGTLYEGEDFQLLFKFNNKYPFDSPE 109
            :|..||:|.  .|.....:|..|.|..:.:|.:..|.|...|.|||..|.|..|....|||:.|:
  Fly    10 KREFKEVMR--SEEIVQCSIKIELVNDSWTELRGEIAGPPDTPYEGGKFVLEIKVPETYPFNPPK 72

  Fly   110 VTFIGTNIPVHPHVYS-NGHICLSILTEDWSPALSVQSVCLSIASMLSSCREKKRPPDNTI 169
            |.|| |.| .||::.| .|.|||.||.::|:.|:::::|.||:.::|::. |...|.|..:
  Fly    73 VRFI-TRI-WHPNISSVTGAICLDILKDNWAAAMTLRTVLLSLQALLAAA-EPDDPQDAVV 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7220NP_001097261.1 UQ_con 46..187 CDD:278603 45/125 (36%)
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 45/126 (36%)
UQ_con 8..149 CDD:278603 45/126 (36%)
UBA_II_E2_UBCD4 163..198 CDD:270574
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438051
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.