DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7220 and Uev1A

DIOPT Version :9

Sequence 1:NP_001097261.1 Gene:CG7220 / 36129 FlyBaseID:FBgn0033544 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001286940.1 Gene:Uev1A / 38613 FlyBaseID:FBgn0035601 Length:145 Species:Drosophila melanogaster


Alignment Length:103 Identity:23/103 - (22%)
Similarity:48/103 - (46%) Gaps:7/103 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LSEWKINIKGFEGTLYEGEDFQLLFKFNNKYPFDSPEVTFIGTNIPVHPHVYSNG---HICLSIL 134
            |:.|...|.|...|.:|...:.|..:...:||.:.|.:.|| |.:.::....:||   |..:.:|
  Fly    45 LTYWIGMIIGPPRTPFENRMYSLKIECGERYPDEPPTLRFI-TKVNINCINQNNGVVDHRSVQML 108

  Fly   135 TEDWSPALSVQSVCLSIASMLSSCREKK--RPPDNTIY 170
            .. ||...:::::...|..:::.....|  :||:.:.:
  Fly   109 AR-WSREYNIKTMLQEIRRIMTMKENLKLAQPPEGSCF 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7220NP_001097261.1 UQ_con 46..187 CDD:278603 23/103 (22%)
Uev1ANP_001286940.1 UBCc 16..142 CDD:214562 23/98 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438177
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.