DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7220 and CG10862

DIOPT Version :9

Sequence 1:NP_001097261.1 Gene:CG7220 / 36129 FlyBaseID:FBgn0033544 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_647823.1 Gene:CG10862 / 38437 FlyBaseID:FBgn0035455 Length:354 Species:Drosophila melanogaster


Alignment Length:124 Identity:44/124 - (35%)
Similarity:59/124 - (47%) Gaps:10/124 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GKPLQLDNSRWERRLHKELMSLIKEPPPGVTIDTESVQQNLSEWKINIKGFEGTLYEGEDFQLLF 97
            |.||.:      .||.:|:.....:...|  ...|.|..||..|...|.|...|:|||..|::..
  Fly   205 GDPLTI------TRLRREISEFSTDQTEG--CKAEMVGDNLFHWVATIPGPSETVYEGGRFRVEI 261

  Fly    98 KFNNKYPFDSPEVTFIGTNIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIASMLS 156
            .|...|||..|.:.|:...  .|.::..:|.|||.||...|||||||..|.:||.|:|:
  Fly   262 VFPRNYPFYPPYLAFLTKT--YHCNIALSGRICLDILGSKWSPALSVSKVLISIMSLLA 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7220NP_001097261.1 UQ_con 46..187 CDD:278603 41/111 (37%)
CG10862NP_647823.1 COG5078 207..354 CDD:227410 43/122 (35%)
UQ_con 212..349 CDD:278603 41/111 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.