powered by:
Protein Alignment CG7220 and CG16894
DIOPT Version :9
Sequence 1: | NP_001097261.1 |
Gene: | CG7220 / 36129 |
FlyBaseID: | FBgn0033544 |
Length: | 190 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_611455.1 |
Gene: | CG16894 / 37280 |
FlyBaseID: | FBgn0034483 |
Length: | 266 |
Species: | Drosophila melanogaster |
Alignment Length: | 53 |
Identity: | 12/53 - (22%) |
Similarity: | 22/53 - (41%) |
Gaps: | 1/53 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 87 LYEGEDFQLLFKFNNKYPFDSPEVTFIGTNIPVHPHVY-SNGHICLSILTEDW 138
:|.|..|:........:|.|....|.:.:...:|||:. .|..:.|:....:|
Fly 56 IYAGSVFRFSILLPENFPADISLPTVVFSTEVLHPHICPQNKTLDLAHFLNEW 108
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45438157 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.