DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7220 and Ap1s1

DIOPT Version :9

Sequence 1:NP_001097261.1 Gene:CG7220 / 36129 FlyBaseID:FBgn0033544 Length:190 Species:Drosophila melanogaster
Sequence 2:XP_006249241.1 Gene:Ap1s1 / 360785 RGDID:1305911 Length:191 Species:Rattus norvegicus


Alignment Length:104 Identity:21/104 - (20%)
Similarity:40/104 - (38%) Gaps:37/104 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMKLFKKPKDKIPKSEILTEPKEPKTPPVSKCGKPLQLDNSRWERRLHKELMSLIKEPPPGVTID 65
            |:...::.|.::.|..:.|..||.|                    ::.:|||.::....|.:.  
  Rat     5 MLLFSRQGKLRLQKWYLATSDKERK--------------------KMVRELMQVVLARKPKMC-- 47

  Fly    66 TESVQQNLSEW---KINIKGFEGTLY-----EGEDFQLL 96
                  :..||   |:..|.: .:||     ||:|.:|:
  Rat    48 ------SFLEWRDLKVVYKRY-ASLYFCCAIEGQDNELI 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7220NP_001097261.1 UQ_con 46..187 CDD:278603 14/59 (24%)
Ap1s1XP_006249241.1 Clat_adaptor_s 1..142 CDD:250451 21/104 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 219 1.000 Domainoid score I2556
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 246 1.000 Inparanoid score I3189
OMA 1 1.010 - - QHG55135
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002332
OrthoInspector 1 1.000 - - otm45300
orthoMCL 1 0.900 - - OOG6_102995
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1538
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.970

Return to query results.
Submit another query.