DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7220 and morgue

DIOPT Version :9

Sequence 1:NP_001097261.1 Gene:CG7220 / 36129 FlyBaseID:FBgn0033544 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_608833.1 Gene:morgue / 33648 FlyBaseID:FBgn0027609 Length:491 Species:Drosophila melanogaster


Alignment Length:172 Identity:49/172 - (28%)
Similarity:73/172 - (42%) Gaps:54/172 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DNSRWERRLHKELMS-------LIK----------------EPPPGVTI---------------D 65
            ||..| .||:..|||       ||:                :..||..:               :
  Fly   290 DNPNW-YRLYGALMSSCFCRTCLIEMGGRGQDAQEADPQLGDREPGNVMRNNFLRGEANLLNSYE 353

  Fly    66 TESV------QQNLSEWKINIKGFEGTLYEGEDFQLLFKFNNKYPFDSPEVTFIGTNIPVHPHVY 124
            :|.:      :|| :.|:..|.|..|:.|||..|.|...|..:||...|.|.|: |.| :||:|.
  Fly   354 SEGISAIPLDRQN-NYWQATILGPPGSPYEGGKFFLFIYFPERYPMTPPTVRFL-TKI-LHPNVS 415

  Fly   125 SNGHICLSILTE-DWSPALSVQSVCLSIASMLSS-----CRE 160
            .:|.:.:.|..: :||.||:|..|.||:.|:|:.     |.|
  Fly   416 RHGDVGIDIFQQHNWSLALNVAKVLLSVQSLLTDPYTEVCME 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7220NP_001097261.1 UQ_con 46..187 CDD:278603 46/165 (28%)
morgueNP_608833.1 DUF3664 92..190 CDD:289191
F-box-like 234..275 CDD:289689
UQ_con 342..479 CDD:278603 37/119 (31%)
COG5078 355..485 CDD:227410 37/106 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.