DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7220 and CG5440

DIOPT Version :9

Sequence 1:NP_001097261.1 Gene:CG7220 / 36129 FlyBaseID:FBgn0033544 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001285558.1 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster


Alignment Length:147 Identity:51/147 - (34%)
Similarity:76/147 - (51%) Gaps:16/147 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RRLHKELMSLIKEPPPGVTIDTESVQQNLSEWKINIKGFEGTLYEGEDFQLLFKFNNKYPFDSPE 109
            :|:.|||..:.::||...:...:  :.||.||...|.|...::||...|:|...|..:|||..|.
  Fly    24 KRIQKELDEITRDPPQYCSAGPK--EDNLYEWTSTIIGPADSVYENGIFKLDIFFPVEYPFAPPV 86

  Fly   110 VTFIGTNIPV-HPHVYSNGHICLSILTEDWSPALSVQSVCLSIASMLSSCREKKRPPD------N 167
            |.|   ..|: |.:::..|.|||.||.|.|||||::..:.|||.|:|:.|    .|.|      .
  Fly    87 VIF---RTPIYHCNIHRLGFICLDILKEKWSPALTISKILLSICSLLTDC----NPKDPLMAKIG 144

  Fly   168 TIYVKTCNKNPKKTKWW 184
            |.|:|...::.||.:.|
  Fly   145 TEYLKNRAEHDKKARLW 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7220NP_001097261.1 UQ_con 46..187 CDD:278603 51/146 (35%)
CG5440NP_001285558.1 COG5078 19..168 CDD:227410 51/147 (35%)
UQ_con 25..162 CDD:278603 51/146 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.