DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7220 and lwr

DIOPT Version :9

Sequence 1:NP_001097261.1 Gene:CG7220 / 36129 FlyBaseID:FBgn0033544 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001259833.1 Gene:lwr / 33226 FlyBaseID:FBgn0010602 Length:159 Species:Drosophila melanogaster


Alignment Length:152 Identity:43/152 - (28%)
Similarity:74/152 - (48%) Gaps:25/152 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RLHKELMSLIKEPP----------PGVTIDTESVQQNLSEWKINIKGFEGTLYEGEDFQLLFKFN 100
            ||.:|..:..|:.|          |..|:       ||..|:..|.|.:.|.:||..::|...|.
  Fly     8 RLGEERKAWRKDHPFGFVARPAKNPDGTL-------NLMIWECAIPGKKSTPWEGGLYKLRMIFK 65

  Fly   101 NKYPFDSPEVTFIGTNIPV-HPHVYSNGHICLSILTE--DWSPALSVQSVCLSIASMLS--SCRE 160
            :.||...|:..|   ..|: ||:||.:|.:|||:|.|  ||.||::::.:.|.|..:|:  :.::
  Fly    66 DDYPTSPPKCKF---EPPLFHPNVYPSGTVCLSLLDEEKDWRPAITIKQILLGIQDLLNEPNIKD 127

  Fly   161 KKRPPDNTIYVKTCNKNPKKTK 182
            ..:....|||.:...:..|:.:
  Fly   128 PAQAEAYTIYCQNRLEYEKRVR 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7220NP_001097261.1 UQ_con 46..187 CDD:278603 43/152 (28%)
lwrNP_001259833.1 UQ_con 8..152 CDD:395127 43/152 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438174
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.