DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7220 and ben

DIOPT Version :9

Sequence 1:NP_001097261.1 Gene:CG7220 / 36129 FlyBaseID:FBgn0033544 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001162752.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster


Alignment Length:113 Identity:40/113 - (35%)
Similarity:65/113 - (57%) Gaps:4/113 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RRLHKELMSLIKEPPPGVTIDTESVQQNLSEWKINIKGFEGTLYEGEDFQLLFKFNNKYPFDSPE 109
            ||:.||...|::||.||:....:  :.|...:.:.:.|...:.:||..|:|.......||..:|:
  Fly     6 RRIIKETQRLMQEPVPGINAIPD--ENNARYFHVIVTGPNDSPFEGGVFKLELFLPEDYPMSAPK 68

  Fly   110 VTFIGTNIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIASMLSS 157
            |.|| |.| .||::...|.|||.:|.:.|||||.::::.|||.::||:
  Fly    69 VRFI-TKI-YHPNIDRLGRICLDVLKDKWSPALQIRTILLSIQALLSA 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7220NP_001097261.1 UQ_con 46..187 CDD:278603 39/112 (35%)
benNP_001162752.1 UBCc 3..149 CDD:412187 40/113 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438115
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.