DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7220 and Ube2e3

DIOPT Version :9

Sequence 1:NP_001097261.1 Gene:CG7220 / 36129 FlyBaseID:FBgn0033544 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001041322.2 Gene:Ube2e3 / 295686 RGDID:1308894 Length:207 Species:Rattus norvegicus


Alignment Length:177 Identity:59/177 - (33%)
Similarity:91/177 - (51%) Gaps:20/177 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EPKEPKTPPVSKCGKPLQLDN------SRWERRLHKELMSLIKEPPPGVTIDTESVQQNLSEWKI 78
            |.:|.:.|..::..|..:|.:      |...:|:.|||..:..:|||..:...:.  .|:.||:.
  Rat    33 EEQEERKPSATQQKKNTKLSSKTTAKLSTSAKRIQKELAEITLDPPPNCSAGPKG--DNIYEWRS 95

  Fly    79 NIKGFEGTLYEGEDFQLLFKFNNKYPFDSPEVTFIGTNIPVHPHVYSNGHICLSILTEDWSPALS 143
            .|.|..|::|||..|.|...|::.|||..|:||| .|.| .|.::.|.|.|||.||.::|||||:
  Rat    96 TILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTF-RTRI-YHCNINSQGVICLDILKDNWSPALT 158

  Fly   144 VQSVCLSIASMLSSCREKKRPPD------NTIYVKTCNKNPKKTKWW 184
            :..|.|||.|:|:.|    .|.|      .|.|:....::.:..:.|
  Rat   159 ISKVLLSICSLLTDC----NPADPLVGSIATQYLTNRAEHDRIARQW 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7220NP_001097261.1 UQ_con 46..187 CDD:278603 53/145 (37%)
Ube2e3NP_001041322.2 UQ_con 65..202 CDD:395127 53/145 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.