DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7220 and rhp6

DIOPT Version :9

Sequence 1:NP_001097261.1 Gene:CG7220 / 36129 FlyBaseID:FBgn0033544 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_592876.1 Gene:rhp6 / 2542622 PomBaseID:SPAC18B11.07c Length:151 Species:Schizosaccharomyces pombe


Alignment Length:136 Identity:45/136 - (33%)
Similarity:68/136 - (50%) Gaps:6/136 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RRLHKELMSLIKEPPPGVTIDTESVQQNLSEWKINIKGFEGTLYEGEDFQLLFKFNNKYPFDSPE 109
            |||.::...:.::||.||:  ...|..|:..|...|.|...|.:|...|:|:..|:.:||...|.
pombe     7 RRLMRDFKRMQQDPPAGVS--ASPVSDNVMLWNAVIIGPADTPFEDGTFKLVLSFDEQYPNKPPL 69

  Fly   110 VTFIGTNIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIASMLSSCREKKRPPDNTIYVKTC 174
            |.|:.|..  ||:||:||.:||.||...|||...|.::..||.|:|:.  .....|.|....:..
pombe    70 VKFVSTMF--HPNVYANGELCLDILQNRWSPTYDVAAILTSIQSLLND--PNNASPANAEAAQLH 130

  Fly   175 NKNPKK 180
            .:|.|:
pombe   131 RENKKE 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7220NP_001097261.1 UQ_con 46..187 CDD:278603 44/135 (33%)
rhp6NP_592876.1 COG5078 1..150 CDD:227410 45/136 (33%)
UQ_con 8..145 CDD:278603 44/135 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.