DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7220 and ubc-14

DIOPT Version :9

Sequence 1:NP_001097261.1 Gene:CG7220 / 36129 FlyBaseID:FBgn0033544 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001370084.1 Gene:ubc-14 / 173228 WormBaseID:WBGene00006709 Length:170 Species:Caenorhabditis elegans


Alignment Length:159 Identity:47/159 - (29%)
Similarity:66/159 - (41%) Gaps:34/159 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RRLHKELMSLIKEPPPGV---TIDTESVQQNLSEWKINIKGFEGTLYEGEDFQLLFKFNNKYPFD 106
            :||..|...|...||.|:   .||    :.|..||:..|.|.|.|.:....|.....|...||..
 Worm     7 KRLMTEYKELTTRPPEGIIAAPID----EDNFFEWECLITGPEETCFANGVFPARITFPQDYPLS 67

  Fly   107 SPEVTFIGTNIPVHPHVYSNGHICLSIL-------------TEDWSPALSVQSVCLSIASMLSSC 158
            .|::.|  |....||::|::|.:|:|||             .|.|||..|::.:.||:.|||:  
 Worm    68 PPKMRF--TCGIFHPNIYADGRVCISILHAPGDDPTGYELSNERWSPVQSIEKILLSVVSMLA-- 128

  Fly   159 REKKRPPDNTIYVKTCNKNPKKTKWWYHD 187
                .|.|.:      ..|....|.|..|
 Worm   129 ----EPNDES------PANVSAAKMWRED 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7220NP_001097261.1 UQ_con 46..187 CDD:278603 46/156 (29%)
ubc-14NP_001370084.1 UQ_con 8..159 CDD:395127 47/158 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.