DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7220 and UBE2QL1

DIOPT Version :9

Sequence 1:NP_001097261.1 Gene:CG7220 / 36129 FlyBaseID:FBgn0033544 Length:190 Species:Drosophila melanogaster
Sequence 2:XP_024310129.1 Gene:UBE2QL1 / 134111 HGNCID:37269 Length:267 Species:Homo sapiens


Alignment Length:161 Identity:38/161 - (23%)
Similarity:71/161 - (44%) Gaps:27/161 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RRLHKELMSLIKEPPPGVTIDTESVQQNLSEWKINIKGF--EGTLYE-----GEDFQLL-FKFNN 101
            |||.|||..:.:.....:::  |.|.::|.:|.:.:...  :..|::     ..:|.|| ..|.:
Human   104 RRLMKELQDIARLSDRFISV--ELVDESLFDWNVKLHQVDKDSVLWQDMKETNTEFILLNLTFPD 166

  Fly   102 KYPFDSPEVTFIGTNIPVHPHVYSNGHICLSILT-EDWSPALSVQSVCLSIASMLSS-----CRE 160
            .:||..|.:..:...:. :.:|...|.||:.:|| ..||.|.:|::|....|:.|..     ||:
Human   167 NFPFSPPFMRVLSPRLE-NGYVLDGGAICMELLTPRGWSSAYTVEAVMRQFAASLVKGQGRICRK 230

  Fly   161 --------KKRPPDNTIYVKTCNKNPKKTKW 183
                    .::..:.|.  |:..|..:|..|
Human   231 AGKSKKSFSRKEAEATF--KSLVKTHEKYGW 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7220NP_001097261.1 UQ_con 46..187 CDD:278603 37/160 (23%)
UBE2QL1XP_024310129.1 UBCc 103..>221 CDD:238117 30/119 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.