DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7220 and AgaP_AGAP005324

DIOPT Version :9

Sequence 1:NP_001097261.1 Gene:CG7220 / 36129 FlyBaseID:FBgn0033544 Length:190 Species:Drosophila melanogaster
Sequence 2:XP_315339.4 Gene:AgaP_AGAP005324 / 1276032 VectorBaseID:AGAP005324 Length:229 Species:Anopheles gambiae


Alignment Length:199 Identity:142/199 - (71%)
Similarity:159/199 - (79%) Gaps:18/199 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DKIPKSEILTEPKEPKTP--PVSKCGK-PLQLDN---------------SRWERRLHKELMSLIK 56
            |:.|:..||.:.|..::|  .||.|.: |:.|:.               |..||||.||||||||
Mosquito    31 DQSPRKSILRQQKYFRSPSCAVSVCVRVPVPLNGVNSMSKPDCSKKTAMSPSERRLQKELMSLIK 95

  Fly    57 EPPPGVTIDTESVQQNLSEWKINIKGFEGTLYEGEDFQLLFKFNNKYPFDSPEVTFIGTNIPVHP 121
            ||||||::|.|||.|||::|.|||.|.||||||||.||||||||||||||||||||||:|||:||
Mosquito    96 EPPPGVSVDEESVSQNLTQWIINIDGVEGTLYEGEHFQLLFKFNNKYPFDSPEVTFIGSNIPIHP 160

  Fly   122 HVYSNGHICLSILTEDWSPALSVQSVCLSIASMLSSCREKKRPPDNTIYVKTCNKNPKKTKWWYH 186
            ||||||||||||||:|||||||||||||||:|||||||||:|||||.||||||||||||||||||
Mosquito   161 HVYSNGHICLSILTDDWSPALSVQSVCLSISSMLSSCREKRRPPDNGIYVKTCNKNPKKTKWWYH 225

  Fly   187 DDSV 190
            ||||
Mosquito   226 DDSV 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7220NP_001097261.1 UQ_con 46..187 CDD:278603 123/140 (88%)
AgaP_AGAP005324XP_315339.4 UQ_con 85..226 CDD:278603 123/140 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 252 1.000 Domainoid score I4796
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10119
Inparanoid 1 1.050 285 1.000 Inparanoid score I5246
OMA 1 1.010 - - QHG55135
OrthoDB 1 1.010 - - D1522577at2759
OrthoFinder 1 1.000 - - FOG0002332
OrthoInspector 1 1.000 - - oto108018
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1538
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.