DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7220 and AgaP_AGAP002251

DIOPT Version :9

Sequence 1:NP_001097261.1 Gene:CG7220 / 36129 FlyBaseID:FBgn0033544 Length:190 Species:Drosophila melanogaster
Sequence 2:XP_307933.4 Gene:AgaP_AGAP002251 / 1269310 VectorBaseID:AGAP002251 Length:167 Species:Anopheles gambiae


Alignment Length:137 Identity:43/137 - (31%)
Similarity:67/137 - (48%) Gaps:24/137 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LHKELMSLIKEPPPGVT---IDTESVQQNLSEWKINIKGFEGTLYEGEDFQLLFKFNNKYPFDSP 108
            |.|:|..|.|.|..|.:   ||    ..::..|::.|.|...|||||..|:....|..:||...|
Mosquito    10 LKKQLAELSKNPVEGFSAGLID----DNDIFRWEVLIIGPPDTLYEGGFFKAHLHFPKEYPLRPP 70

  Fly   109 EVTFIGTNIPVHPHVYSNGHICLSIL-------------TEDWSPALSVQSVCLSIASMLSSCRE 160
            .:.|: |.| .||::..||.:|:|||             :|.|.|..:|:::.:|:.|||:...:
Mosquito    71 RMKFV-TEI-WHPNIDRNGDVCISILHEPGDDKWGYEKASERWLPVHTVETILISVISMLADPND 133

  Fly   161 KKRPPDN 167
            :.  |.|
Mosquito   134 ES--PAN 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7220NP_001097261.1 UQ_con 46..187 CDD:278603 43/137 (31%)
AgaP_AGAP002251XP_307933.4 COG5078 1..166 CDD:227410 43/137 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.