DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7220 and AgaP_AGAP012754

DIOPT Version :9

Sequence 1:NP_001097261.1 Gene:CG7220 / 36129 FlyBaseID:FBgn0033544 Length:190 Species:Drosophila melanogaster
Sequence 2:XP_024667069.1 Gene:AgaP_AGAP012754 / 1268403 VectorBaseID:AGAP012754 Length:179 Species:Anopheles gambiae


Alignment Length:143 Identity:58/143 - (40%)
Similarity:78/143 - (54%) Gaps:16/143 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IPKSEILTEPKEPKT-PPVSKCGKPLQLDNSRWERRLHKELMSLIKEPPPGVTIDTESVQQNLSE 75
            :||    .|.||.|: |.:||.     |..|  .:|:.|||..:..:|||..:...:.  .||.|
Mosquito    52 VPK----PETKESKSNPKISKA-----LGTS--AKRIQKELAEITLDPPPNCSAGPKG--DNLYE 103

  Fly    76 WKINIKGFEGTLYEGEDFQLLFKFNNKYPFDSPEVTFIGTNIPVHPHVYSNGHICLSILTEDWSP 140
            |...|.|..|::|||..|.|...|:.:|||..|:||| .|.| .|.::.|.|.|||.||.::|||
Mosquito   104 WVSTILGPPGSVYEGGVFFLDIHFSPEYPFKPPKVTF-RTRI-YHCNINSQGVICLDILKDNWSP 166

  Fly   141 ALSVQSVCLSIAS 153
            ||::..|.|||.|
Mosquito   167 ALTISKVLLSICS 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7220NP_001097261.1 UQ_con 46..187 CDD:278603 47/108 (44%)
AgaP_AGAP012754XP_024667069.1 UQ_con 76..>179 CDD:306648 46/106 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.