DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7220 and Ube2w

DIOPT Version :9

Sequence 1:NP_001097261.1 Gene:CG7220 / 36129 FlyBaseID:FBgn0033544 Length:190 Species:Drosophila melanogaster
Sequence 2:XP_038966831.1 Gene:Ube2w / 100909445 RGDID:6503620 Length:183 Species:Rattus norvegicus


Alignment Length:154 Identity:55/154 - (35%)
Similarity:81/154 - (52%) Gaps:45/154 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KPLQLDNSRW-----------ERRLHKELMSLIKEPPPGVTIDTESVQQNLSEWKINIKGFEGTL 87
            :||:| ..||           ::||.|||::|..:||||:|::.:|||.::::|.::::|..|||
  Rat    14 RPLRL-RPRWPWGDGFIMASMQKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTL 77

  Fly    88 YEGEDFQLLFKFNNKYPFDSPEVTFIGTNIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIA 152
            ||||.|||||||:::||||||:.|                           .|.   :|.|....
  Rat    78 YEGEKFQLLFKFSSRYPFDSPQKT---------------------------GPR---RSQCNRSV 112

  Fly   153 SMLSSC--REKKRPPDNTIYVKTC 174
            |.||:|  ..||| .|:.|....|
  Rat   113 SALSACFPAAKKR-DDHQIIPFMC 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7220NP_001097261.1 UQ_con 46..187 CDD:278603 50/131 (38%)
Ube2wXP_038966831.1 UBCc 36..>99 CDD:412187 35/62 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 219 1.000 Domainoid score I2556
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 246 1.000 Inparanoid score I3189
OMA 1 1.010 - - QHG55135
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002332
OrthoInspector 1 1.000 - - otm45300
orthoMCL 1 0.900 - - OOG6_102995
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1538
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.970

Return to query results.
Submit another query.