DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7220 and E330021D16Rik

DIOPT Version :9

Sequence 1:NP_001097261.1 Gene:CG7220 / 36129 FlyBaseID:FBgn0033544 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001188319.1 Gene:E330021D16Rik / 100502936 MGIID:2141773 Length:371 Species:Mus musculus


Alignment Length:160 Identity:44/160 - (27%)
Similarity:74/160 - (46%) Gaps:19/160 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RLHKELMSLIK-EPPPGVTIDTESVQQNLSEWKINIKGF--EGTLY---------EGEDFQLL-F 97
            ||.|||..:.: :.....|...|.:..:|.:|.:.::..  :..||         ||.|:.|| |
Mouse   205 RLMKELREIYRSQSYKSGTFSVELINDSLYDWHVKLRKVDPDSCLYRDLQRLKQKEGIDYILLNF 269

  Fly    98 KFNNKYPFDSPEVTFIGTNIPV--HPHVYSNGHICLSILT-EDWSPALSVQSVCLSIASMLSSCR 159
            .|.:.:|||.|   |:...:||  ..:|...|.:|:.:|| :.||.|.|::||.|.|.:.|...:
Mouse   270 SFKDNFPFDPP---FVRVVLPVLSDGYVLDGGALCMELLTNQGWSSAYSIESVILQINATLVKGK 331

  Fly   160 EKKRPPDNTIYVKTCNKNPKKTKWWYHDDS 189
            .:.|...:..|.:...:...|:....|:.|
Mouse   332 ARVRFGVDNHYTEQVARRVYKSMVLKHEKS 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7220NP_001097261.1 UQ_con 46..187 CDD:278603 42/156 (27%)
E330021D16RikNP_001188319.1 RWD 8..>88 CDD:383087
UBCc 203..>328 CDD:381827 38/125 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.