DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12338 and TDA3

DIOPT Version :9

Sequence 1:NP_001286292.1 Gene:CG12338 / 36128 FlyBaseID:FBgn0033543 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_011873.1 Gene:TDA3 / 856400 SGDID:S000001051 Length:523 Species:Saccharomyces cerevisiae


Alignment Length:486 Identity:86/486 - (17%)
Similarity:141/486 - (29%) Gaps:168/486 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 HFGVLGSGIIGLTTALELQKEFP-----TARVSVIADRFNEDTVSYVAAGIFRPGTSFMGPTQKI 61
            |..::|.||||..||..| .:.|     |..:::|..|......|..|.|:.   .|:..|.|.:
Yeast    23 HIVIVGGGIIGCCTAYYL-TQHPSFSPSTHHITIIESRRIAGGASGKAGGLL---ASWAFPHQIV 83

  Fly    62 -----TQQWMTDAF---NYWDELRRS--------KEAPLAGVCQLSGYIYS------RTSPSIVR 104
                 ..|.::|.:   |.||..|.:        :|..:....:||...|:      :..|..:.
Yeast    84 PLSFQLHQELSDEYDGENNWDYRRLTTVSLEADVREEVIENYERLSKKAYNLNVPPPKKRPGYIS 148

  Fly   105 NHF-------------------------------IEKLLPVYRRATEEELR-------------- 124
            |.|                               :...:|.....|.|.:|              
Yeast   149 NKFNIGDSNSSLSSSGSSLKNDSASNEEEGSDIHVSSSVPSLHSLTNERMRSHTNSASDLDSVSP 213

  Fly   125 -----------------------LCNGGWKYGSFFTTCLTESRLFLPYATKKFLENG------GE 160
                                   |.|.....|...||.......|..:...|.:|.|      |:
Yeast   214 VEQLRETNIHNPLPADLDWIRRELVNDWSSLGGTDTTAQLHPYKFTHFILSKAMETGAVDLLLGK 278

  Fly   161 VV------RQHVNSFFEVPQNIDLLLNCTG--------MGAKELCGDQHLVPIR----GQVLKVR 207
            ||      ...|:|...:|..:....|..|        :|.  :..|::..||.    .|::...
Yeast   279 VVGLKCDEMDCVHSLKYLPSVVKNRRNSRGHAENPDIKLGT--IFNDENAKPIEINDIQQIVLSM 341

  Fly   208 APWVKTAF-------YGDYDTYVLPGFETVT--------------------------LGGCRQFD 239
            .||.....       ...:...:.|..:||:                          :..|.:.|
Yeast   342 GPWTSKILKDCPISGLRAHSVTIKPSEKTVSPYAILAELKVNDREFFSPEMYARKDEVYVCGEGD 406

  Fly   240 S-YNTEWCKYDSMAIRERCYDLL-------PSLRKAEIVRECVGLRPHRSVVRVEPELITNPEGR 296
            : .|......|...:.|:|.:|.       |:|.|..::|:.....|..:|......||.....:
Yeast   407 TLVNIPESSDDVEVVSEKCDELYHYVSKLSPTLSKGHLLRKQACFLPVLNVPTSSGPLIGETNVK 471

  Fly   297 RLKVVHNYGHGGYGVTTAPGTAMYAVRLVRD 327
            .|.:..  ||..:|:..||.|......::.|
Yeast   472 DLYIAS--GHSCWGINNAPATGKLMAEILLD 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12338NP_001286292.1 DAO 5..324 CDD:279590 84/478 (18%)
TDA3NP_011873.1 DadA <251..516 CDD:223737 45/254 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0665
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.