DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12338 and DDO

DIOPT Version :9

Sequence 1:NP_001286292.1 Gene:CG12338 / 36128 FlyBaseID:FBgn0033543 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001359037.1 Gene:DDO / 8528 HGNCID:2727 Length:341 Species:Homo sapiens


Alignment Length:327 Identity:128/327 - (39%)
Similarity:195/327 - (59%) Gaps:11/327 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VLGSGIIGLTTALELQKEFPTARVSVIADRFNEDTVSYVAAGIFRPGTSFMGP--TQKITQQWMT 67
            |:|:|::||:||:.:.|..|...|::|:|:|..||.|.||||:..|.|....|  |||   ||..
Human     8 VVGAGVVGLSTAVCISKLVPRCSVTIISDKFTPDTTSDVAAGMLIPHTYPDTPIHTQK---QWFR 69

  Fly    68 DAFNYWDELRRSKEAPLAGVCQLSGYIYSRTSPSIVRNHFIEKLLPVYRRATEEELRLCNGGWKY 132
            :.||:...:..|.||..|||..:||:...:::|:.....:.:.:|. :|:.||.||:.. ..:.:
Human    70 ETFNHLFAIANSAEAGDAGVHLVSGWQIFQSTPTEEVPFWADVVLG-FRKMTEAELKKF-PQYVF 132

  Fly   133 GSFFTTCLTESRLFLPYATKKFLENGGEVVRQHVNSFFEVPQNIDLLLNCTGMGAKELCGDQHLV 197
            |..|||...|...:||:..|:...:||..:.:.:...:|:..:.|:::||:|:|:::|.||..:.
Human   133 GQAFTTLKCECPAYLPWLEKRIKGSGGWTLTRRIEDLWELHPSFDIVVNCSGLGSRQLAGDSKIF 197

  Fly   198 PIRGQVLKVRAPWVKTAFYGDYD--TYVLPGFETVTLGGCRQFDSYNTEWCKYDSMAIRERCYDL 260
            |:|||||:|:||||: .|..|..  ||:.||...|||||.||...:|......:|..|..||..|
Human   198 PVRGQVLQVQAPWVE-HFIRDGSGLTYIYPGTSHVTLGGTRQKGDWNLSPDAENSREILSRCCAL 261

  Fly   261 LPSLRKAEIVRECVGLRPHRSVVRVEPELITNPEGRRLKVVHNYGHGGYGVTTAPGTAMYAVRLV 325
            .|||..|..:||.|||||:|..||::.||:.. :|:||.|||:||||..|::...|||:.|.|||
Human   262 EPSLHGACNIREKVGLRPYRPGVRLQTELLAR-DGQRLPVVHHYGHGSGGISVHWGTALEAARLV 325

  Fly   326 RD 327
            .:
Human   326 SE 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12338NP_001286292.1 DAO 5..324 CDD:279590 125/322 (39%)
DDONP_001359037.1 DAO 30..324 CDD:334462 116/300 (39%)
Microbody targeting signal. /evidence=ECO:0000255 339..341
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159639
Domainoid 1 1.000 205 1.000 Domainoid score I2930
eggNOG 1 0.900 - - E1_COG0665
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H101531
Inparanoid 1 1.050 209 1.000 Inparanoid score I3686
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63703
OrthoDB 1 1.010 - - D1363414at2759
OrthoFinder 1 1.000 - - FOG0001083
OrthoInspector 1 1.000 - - otm41767
orthoMCL 1 0.900 - - OOG6_100720
Panther 1 1.100 - - O PTHR11530
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R881
SonicParanoid 1 1.000 - - X916
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.