DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12338 and pipox

DIOPT Version :9

Sequence 1:NP_001286292.1 Gene:CG12338 / 36128 FlyBaseID:FBgn0033543 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001313319.1 Gene:pipox / 558601 ZFINID:ZDB-GENE-110627-2 Length:387 Species:Danio rerio


Alignment Length:407 Identity:80/407 - (19%)
Similarity:125/407 - (30%) Gaps:160/407 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VLGSGIIGLTTALELQKE-----------FPTARVS------VIADRFNEDTVSYVAAGIFRPGT 52
            |:|:||.|..||.:|.|.           .|.:|.|      :|...:.||..:           
Zfish    10 VIGAGIQGSCTAYQLAKNKQKTLLLEQFVLPHSRGSSHGQTRIIRKAYEEDFYT----------- 63

  Fly    53 SFMGPTQKITQQWMTDAFNYWDELRRSKEAPLAGVCQLSGYIYSRTSPSIV---RNHFIEKLLPV 114
                       |.|.:::..|.||.:.     |||     .:|.||...::   ::....||...
Zfish    64 -----------QMMQESYELWAELEKE-----AGV-----ELYRRTGLLVMGPEKSEGFSKLKDT 107

  Fly   115 YRRATEEELRLCNGGWKYGSFFTTCLTESRLFLPYATKKFLENGGEVVRQHVNSFFEV------P 173
            .:|..                ..|...|.:.|..:.:...|..|...:   :::|..|      .
Zfish   108 MQRHK----------------IPTVFLEKQEFNEHISNVNLSEGNGAL---IDTFAGVLYAERSL 153

  Fly   174 QNIDLLLNCTGMGAKELCGDQHLVPI---------------RGQVLKVRA-PWVKTAF------- 215
            |.:..|..|:|...|:   .|.:..:               ||:.:.:.| ||..|..       
Zfish   154 QAVQRLFQCSGGVLKD---GQTVTGVSPGAVVTVSTGSAVYRGKSVVITAGPWANTLLAHAGLQL 215

  Fly   216 -----------------------------------YGDYDTYVLPGFETVTL-GGCRQFDSYNTE 244
                                               .|:||.|.||..|...| ..|....| .|:
Zfish   216 PLKVVKINVCYWKEKIPGTYSVDQSFPCFIQMEPKEGEYDIYGLPSNEYPGLMKVCYHMGS-ETD 279

  Fly   245 WCKYDSMAIRERCYDLLPSLRKAEIVRECV-GLRPHRSVVR-----VEPE----LITNPE-GRRL 298
            ..:.|....|.. .|:|     |..|..|: ||.|..:||.     |.|:    |.::|. |   
Zfish   280 PDERDKQTDRGD-IDIL-----ARYVTRCLPGLVPAPAVVESCMYTVTPDHHFVLDSHPSYG--- 335

  Fly   299 KVVHNYGHGGYGVTTAP 315
            .::...|..|:|...:|
Zfish   336 NIIIGAGFSGHGFKFSP 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12338NP_001286292.1 DAO 5..324 CDD:279590 80/407 (20%)
pipoxNP_001313319.1 soxA_mon 6..385 CDD:130444 80/407 (20%)
NADB_Rossmann 6..>66 CDD:304358 16/77 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0665
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.