DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12338 and PIPOX

DIOPT Version :9

Sequence 1:NP_001286292.1 Gene:CG12338 / 36128 FlyBaseID:FBgn0033543 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_057602.2 Gene:PIPOX / 51268 HGNCID:17804 Length:390 Species:Homo sapiens


Alignment Length:416 Identity:74/416 - (17%)
Similarity:123/416 - (29%) Gaps:157/416 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VLGSGIIGLTTALELQKEFPTARVSVIADRFNEDTVSYVAAGIFRP---GTSFMGPTQKITQQWM 66
            |:|:||.|..||..|.|.  ..|: ::.::|            |.|   |:|. |.::.|.:.::
Human    12 VIGAGIQGCFTAYHLAKH--RKRI-LLLEQF------------FLPHSRGSSH-GQSRIIRKAYL 60

  Fly    67 TD--------AFNYWDELRRSKEAPL---AGVCQL------------SGYIYSRTSPSIVRNHFI 108
            .|        .:..|.:|.......|   .|:..|            :.....|.....:.:..:
Human    61 EDFYTRMMHECYQIWAQLEHEAGTQLHRQTGLLLLGMKENQELKTIQANLSRQRVEHQCLSSEEL 125

  Fly   109 EKLLPVYR----------------------RATEEELRLCNGGWKYG--------SFFTTCLTES 143
            ::..|..|                      ||.::.:|...|..:.|        ....|..|.|
Human   126 KQRFPNIRLPRGEVGLLDNSGGVIYAYKALRALQDAIRQLGGIVRDGEKVVEINPGLLVTVKTTS 190

  Fly   144 RLFLPYATKKFLENGGEVVRQHVNSFFEVPQNIDLLLNCTGMGAKELCGDQHLVPIRGQVLKVRA 208
            |   .|..|..:...|....|.:.     |..|::.|                     |.|::..
Human   191 R---SYQAKSLVITAGPWTNQLLR-----PLGIEMPL---------------------QTLRINV 226

  Fly   209 PWVKTAFYGDYD-TYVLPGFETVTLGGCRQFDSYNTEWCKYDSMAIRERCYDLLPSLRKAEI--- 269
            .:.:....|.|. :...|.|  :.||.| ....|.....:|             |.|.|...   
Human   227 CYWREMVPGSYGVSQAFPCF--LWLGLC-PHHIYGLPTGEY-------------PGLMKVSYHHG 275

  Fly   270 ------VREC------VG--------LRPHRSVVRVEPELI-----TNPEGRRL---------KV 300
                  .|:|      :|        :|.|...::.||.:|     ||....:.         .:
Human   276 NHADPEERDCPTARTDIGDVQILSSFVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNI 340

  Fly   301 VHNYGHGGYGVTTAP--GTAMYAVRL 324
            |...|..|:|...||  |..:|.:.:
Human   341 VIGAGFSGHGFKLAPVVGKILYELSM 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12338NP_001286292.1 DAO 5..324 CDD:279590 74/414 (18%)
PIPOXNP_057602.2 soxA_mon 8..388 CDD:130444 74/416 (18%)
NAD_binding_8 12..>38 CDD:290186 10/28 (36%)
Microbody targeting signal. /evidence=ECO:0000255 388..390
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0665
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.