DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12338 and smf-3

DIOPT Version :9

Sequence 1:NP_001286292.1 Gene:CG12338 / 36128 FlyBaseID:FBgn0033543 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_500235.4 Gene:smf-3 / 177044 WormBaseID:WBGene00004878 Length:560 Species:Caenorhabditis elegans


Alignment Length:34 Identity:14/34 - (41%)
Similarity:16/34 - (47%) Gaps:5/34 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 LCNGG---WKYGSFFTTCLTESRLFL-PYATKKF 154
            |.||.   |. |...|.|.|.:.||| .|..:||
 Worm   149 LSNGVIPLWA-GVLITICDTFTFLFLEKYGVRKF 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12338NP_001286292.1 DAO 5..324 CDD:279590 14/34 (41%)
smf-3NP_500235.4 nramp 42..447 CDD:162246 14/34 (41%)
Nramp 64..451 CDD:279852 14/34 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0665
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.