DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12338 and DAO

DIOPT Version :9

Sequence 1:NP_001286292.1 Gene:CG12338 / 36128 FlyBaseID:FBgn0033543 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001908.3 Gene:DAO / 1610 HGNCID:2671 Length:347 Species:Homo sapiens


Alignment Length:359 Identity:121/359 - (33%)
Similarity:178/359 - (49%) Gaps:55/359 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHFGVLGSGIIGLTTALELQKEFPTA----RVSVIADRFNEDTVSYVAAGIFRPGTSFMGPTQKI 61
            |...|:|:|:|||:|||.:.:.:.:.    .:.|.||||...|.:.||||:::|..|  .|....
Human     1 MRVVVIGAGVIGLSTALCIHERYHSVLQPLDIKVYADRFTPLTTTDVAAGLWQPYLS--DPNNPQ 63

  Fly    62 TQQWMTDAFNYWDELRRSKEAPLAGVCQLSGYIYSRTSPSIVRNHFIEKL--------LPVYRRA 118
            ...|....|:|......|..|...|:..:|||           |.|.|.:        :..:|:.
Human    64 EADWSQQTFDYLLSHVHSPNAENLGLFLISGY-----------NLFHEAIPDPSWKDTVLGFRKL 117

  Fly   119 TEEELRLCNGGWKYGSFFTTCLTESRLFLPYATKKFLENGGEVVRQHVNSFFEVP-QNIDLLLNC 182
            |..||.:. ..:.||.|.|:.:.|.:.:|.:.|::..|.|.:..::.|.||.||. :..|:::||
Human   118 TPRELDMF-PDYGYGWFHTSLILEGKNYLQWLTERLTERGVKFFQRKVESFEEVAREGADVIVNC 181

  Fly   183 TGMGAKELCGDQHLVPIRGQVLKVRAPWVKTAFY------GDYDT-YVLPGFETVTLGGCRQ--- 237
            ||:.|..|..|..|.|.|||::||.|||:|....      |.|:: |::||.:||||||..|   
Human   182 TGVWAGALQRDPLLQPGRGQIMKVDAPWMKHFILTHDPERGIYNSPYIIPGTQTVTLGGIFQLGN 246

  Fly   238 ------FDSYNTEWCKYDSMAIRERCYDLLPSLRKAEIVRECVGLRPHRSVVRVEPE-LITNPEG 295
                  ...:||.|         |.|..|.|:|:.|.|:.|..|.||.|..:|:|.| |.|.|. 
Human   247 WSELNNIQDHNTIW---------EGCCRLEPTLKNARIIGERTGFRPVRPQIRLEREQLRTGPS- 301

  Fly   296 RRLKVVHNYGHGGYGVTTAPGTAMYAVRLVRDLL 329
             ..:|:|||||||||:|...|.|:.|.:|...:|
Human   302 -NTEVIHNYGHGGYGLTIHWGCALEAAKLFGRIL 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12338NP_001286292.1 DAO 5..324 CDD:279590 118/348 (34%)
DAONP_001908.3 DAO 2..329 CDD:396016 118/351 (34%)
Microbody targeting signal 345..347
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159638
Domainoid 1 1.000 205 1.000 Domainoid score I2930
eggNOG 1 0.900 - - E1_COG0665
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 209 1.000 Inparanoid score I3686
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63703
OrthoDB 1 1.010 - - D1363414at2759
OrthoFinder 1 1.000 - - FOG0001083
OrthoInspector 1 1.000 - - otm41767
orthoMCL 1 0.900 - - OOG6_100720
Panther 1 1.100 - - O PTHR11530
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R881
SonicParanoid 1 1.000 - - X916
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.