DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12338 and Dao

DIOPT Version :9

Sequence 1:NP_001286292.1 Gene:CG12338 / 36128 FlyBaseID:FBgn0033543 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001273325.1 Gene:Dao / 13142 MGIID:94859 Length:345 Species:Mus musculus


Alignment Length:339 Identity:121/339 - (35%)
Similarity:183/339 - (53%) Gaps:17/339 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHFGVLGSGIIGLTTALELQKEF-PT--ARVSVIADRFNEDTVSYVAAGIFRPGTSFMGPTQKIT 62
            |...|:|:|:|||:|||.:.:.: ||  ..:.:.||||...|.|.||||:::|..|  .|:....
Mouse     1 MRVAVIGAGVIGLSTALCIHERYHPTQPLHMKIYADRFTPFTTSDVAAGLWQPYLS--DPSNPQE 63

  Fly    63 QQWMTDAFNYWDELRRSKEAPLAGVCQLSGYIYSRTSPSIVRNHFIEKLLPVYRRATEEELRLCN 127
            .:|....|:|......|..|...|:..:|||...|..   |.:.|.:..:..:|:.|..|:.|. 
Mouse    64 AEWSQQTFDYLLSCLHSPNAEKMGLALISGYNLFRDE---VPDPFWKNAVLGFRKLTPSEMDLF- 124

  Fly   128 GGWKYGSFFTTCLTESRLFLPYATKKFLENGGEVVRQHVNSFFEVPQNIDLLLNCTGMGAKELCG 192
            ..:.||.|.|:.|.|.:.:||:.|::..|.|.:::.:.|.|..||.:.:|:::||||:.|..|..
Mouse   125 PDYGYGWFNTSLLLEGKSYLPWLTERLTERGVKLIHRKVESLEEVARGVDVIINCTGVWAGALQA 189

  Fly   193 DQHLVPIRGQVLKVRAPWVK------TAFYGDYDT-YVLPGFETVTLGGCRQFDSYNTEWCKYDS 250
            |..|.|.|||:::|.|||:|      ....|.|:: |::||.:||||||..|..:::......|.
Mouse   190 DASLQPGRGQIIQVEAPWIKHFILTHDPSLGIYNSPYIIPGSKTVTLGGIFQLGNWSGLNSVRDH 254

  Fly   251 MAIRERCYDLLPSLRKAEIVRECVGLRPHRSVVRVEPELITNPEGRRLKVVHNYGHGGYGVTTAP 315
            ..|.:.|..|.|:|:.|.||.|..|.||.|..||:|.|.: :......:|:|||||||||:|...
Mouse   255 NTIWKSCCKLEPTLKNARIVGELTGFRPVRPQVRLEREWL-HFGSSSAEVIHNYGHGGYGLTIHW 318

  Fly   316 GTAMYAVRLVRDLL 329
            |.||.|..|...:|
Mouse   319 GCAMEAANLFGKIL 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12338NP_001286292.1 DAO 5..324 CDD:279590 118/328 (36%)
DaoNP_001273325.1 NADB_Rossmann 1..>24 CDD:389744 10/22 (45%)
DAO 35..327 CDD:334462 107/298 (36%)
Microbody targeting signal 343..345
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850009
Domainoid 1 1.000 199 1.000 Domainoid score I3062
eggNOG 1 0.900 - - E1_COG0665
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 205 1.000 Inparanoid score I3723
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63703
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001083
OrthoInspector 1 1.000 - - otm43819
orthoMCL 1 0.900 - - OOG6_100720
Panther 1 1.100 - - O PTHR11530
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R881
SonicParanoid 1 1.000 - - X916
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.830

Return to query results.
Submit another query.