DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12338 and Dao

DIOPT Version :9

Sequence 1:NP_001286292.1 Gene:CG12338 / 36128 FlyBaseID:FBgn0033543 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_446078.1 Gene:Dao / 114027 RGDID:621138 Length:346 Species:Rattus norvegicus


Alignment Length:347 Identity:120/347 - (34%)
Similarity:183/347 - (52%) Gaps:32/347 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHFGVLGSGIIGLTTALELQKEFPTAR---VSVIADRFNEDTVSYVAAGIFRPGTSFMGPTQKIT 62
            |...|:|:|:|||:|||.:.:.:..|:   :.:.||||...|.|.||||:::|..|  .|:....
  Rat     1 MRVAVIGAGVIGLSTALCIHERYHPAQPLHMKIYADRFTPFTTSDVAAGLWQPYLS--DPSNPQE 63

  Fly    63 QQWMTDAFNYWDELRRSKEAPLAGVCQLSGYIYSRTSPSIVRNHFIEKLLPVYRRATEEELRLCN 127
            .:|....|::......|..|...|:..:|||...|..   |.:.|.:..:..:|:.|..||.:. 
  Rat    64 AEWNQQTFDHLQSCLHSPNAEKMGLALISGYNLFRDE---VPDPFWKSTVLGFRKLTPSELDMF- 124

  Fly   128 GGWKYGSFFTTCLTESRLFLPYATKKFLENGGEVVRQHVNSFFEVPQ-NIDLLLNCTGMGAKELC 191
            ..:.||.|.|:.|.|.:.:|.:.|::..|.|.:.:.:.|.||.||.: .:|:::||||:.|..|.
  Rat   125 PDYSYGWFNTSLLLEGKSYLSWLTERLTERGVKFIHRKVASFEEVVRGGVDVIINCTGVWAGALQ 189

  Fly   192 GDQHLVPIRGQVLKVRAPWVK------TAFYGDYDT-YVLPGFETVTLGGCRQFDSYNTEWCKYD 249
            .|..|.|.|||:::|.|||:|      ....|.|:: |::||.:||||||..|..:::.....:|
  Rat   190 ADASLQPGRGQIIQVEAPWIKHFILTHDPSLGIYNSPYIIPGSKTVTLGGVFQLGNWSELNSVHD 254

  Fly   250 SMAIRERCYDLLPSLRKAEIVRECVGLRPHRSVVRVEPELITNPEGRRLK-------VVHNYGHG 307
            ...|.:.|..|.|:|:.|.|:.|..|.||.|..||:|.|        ||:       |:||||||
  Rat   255 HNTIWKSCCQLEPTLKNARIMGELTGFRPVRPQVRLERE--------RLRFGSSSAEVIHNYGHG 311

  Fly   308 GYGVTTAPGTAMYAVRLVRDLL 329
            |||:|...|.||.|..|...:|
  Rat   312 GYGLTIHWGCAMEAANLFGKIL 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12338NP_001286292.1 DAO 5..324 CDD:279590 117/336 (35%)
DaoNP_446078.1 DAO 2..328 CDD:396016 117/339 (35%)
Microbody targeting signal 344..346
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353690
Domainoid 1 1.000 200 1.000 Domainoid score I2945
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 205 1.000 Inparanoid score I3651
OMA 1 1.010 - - QHG63703
OrthoDB 1 1.010 - - D1363414at2759
OrthoFinder 1 1.000 - - FOG0001083
OrthoInspector 1 1.000 - - otm45899
orthoMCL 1 0.900 - - OOG6_100720
Panther 1 1.100 - - O PTHR11530
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X916
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.910

Return to query results.
Submit another query.