DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab3 and RAB3D

DIOPT Version :9

Sequence 1:NP_001356961.1 Gene:Rab3 / 36127 FlyBaseID:FBgn0005586 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_004274.1 Gene:RAB3D / 9545 HGNCID:9779 Length:219 Species:Homo sapiens


Alignment Length:221 Identity:165/221 - (74%)
Similarity:189/221 - (85%) Gaps:3/221 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASGGDPK-WQKDAADQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVF 64
            |||.||.: ..:||||||||||||||:|||||||||||||||||||||.|||||||||||||||:
Human     1 MASAGDTQAGPRDAADQNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVY 65

  Fly    65 RHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQV 129
            |||||:|||||||||||||||||||||||||||:||||:.|::||.:||||.|||||||||||||
Human    66 RHDKRIKLQIWDTAGQERYRTITTAYYRGAMGFLLMYDIANQESFAAVQDWATQIKTYSWDNAQV 130

  Fly   130 ILVGNKCDMEDQRVISFERGRQLADQLGVEFFETSAKENVNVKAVFERLVDIICDKMSESLDADP 194
            ||||||||:||:||:..|.||:|||.||.||||.|||||:|||.|||||||:||:||:|||:...
Human   131 ILVGNKCDLEDERVVPAEDGRRLADDLGFEFFEASAKENINVKQVFERLVDVICEKMNESLEPSS 195

  Fly   195 TLVGGGQKGQRLTDQPQGTPNANCNC 220
            : .|...||..:.|.|...| ::|:|
Human   196 S-SGSNGKGPAVGDAPAPQP-SSCSC 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab3NP_001356961.1 Rab3 21..185 CDD:206657 138/163 (85%)
RAB3DNP_004274.1 Rab3 22..186 CDD:206657 138/163 (85%)
Effector region. /evidence=ECO:0000250 51..59 7/7 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 190..219 9/30 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 292 1.000 Domainoid score I1515
eggNOG 1 0.900 - - E1_KOG0093
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S282
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1218073at2759
OrthoFinder 1 1.000 - - FOG0000908
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47980
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2742
SonicParanoid 1 1.000 - - X578
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.860

Return to query results.
Submit another query.