DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab3 and YHR022C

DIOPT Version :9

Sequence 1:NP_001356961.1 Gene:Rab3 / 36127 FlyBaseID:FBgn0005586 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_011887.1 Gene:YHR022C / 856417 SGDID:S000001064 Length:256 Species:Saccharomyces cerevisiae


Alignment Length:215 Identity:50/215 - (23%)
Similarity:92/215 - (42%) Gaps:62/215 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KLLIIGNSSVGKTSFLFRYADDSF----------TSAFVSTVGID-------------------- 57
            |:.::|:...||||.:..:...||          :..:..|:..|                    
Yeast    24 KITVMGDDHSGKTSLVRSWLGSSFQISDANRYRVSDLYHKTIQFDTLVKYYRTFGVKGQLPNYAG 88

  Fly    58 FKVK---TVFRH-----DKR--------------VKLQIWDTAGQE-RYRT-ITTAYYRGAMGFI 98
            ||.|   |::..     ::|              :.:|::||...| .|.: :||...|.:...|
Yeast    89 FKAKNSGTIYESCGNFLEERLINANKSTAQRRTSIDVQVFDTNQMEVSYLSELTTLQIRQSDAII 153

  Fly    99 LMYDVTNEDSFNSVQDWVTQIKTYSWD---NAQVILVGNKCDMEDQRVISFERGRQLADQLG--- 157
            |.:|.||:.|..|::.::..|.....:   :..:|:...|||::.:|.|:.|:......:||   
Yeast   154 LCFDSTNDSSLASLESYICIIHHVRLECELDIPIIIACTKCDLDSERTITHEKVLTFIQELGFSP 218

  Fly   158 --VEFFETSAKENVNVKAVF 175
              :::||||:|.||||:.:|
Yeast   219 GNLDYFETSSKFNVNVEDLF 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab3NP_001356961.1 Rab3 21..185 CDD:206657 50/215 (23%)
YHR022CNP_011887.1 Ras_like_GTPase 27..242 CDD:206648 49/212 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0093
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.