DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab3 and SEC4

DIOPT Version :9

Sequence 1:NP_001356961.1 Gene:Rab3 / 36127 FlyBaseID:FBgn0005586 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_116650.1 Gene:SEC4 / 850543 SGDID:S000001889 Length:215 Species:Saccharomyces cerevisiae


Alignment Length:219 Identity:99/219 - (45%)
Similarity:148/219 - (67%) Gaps:15/219 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASGGDPKWQKDAADQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRH 66
            ||.|:.|        ::|.:.|:|:||:|.|||:..|.|:.:|.|..:|::|:|||||:|||..:
Yeast     9 ASSGNGK--------SYDSIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDIN 65

  Fly    67 DKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVIL 131
            .|:||||:||||||||:|||||||||||||.||:||||:|.:|.:::.|...:..::.|.||::|
Yeast    66 GKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLL 130

  Fly   132 VGNKCDMEDQRVISFERGRQLADQLGVEFFETSAKENVNVKAVFERLVDIICDKMSESLDADPTL 196
            ||||.||| .||::.::|..||.:||:.|.|:|||.:.||..:|..|..:|    .|.:|::..:
Yeast   131 VGNKSDME-TRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLI----QEKIDSNKLV 190

  Fly   197 -VGGGQKGQRLTDQPQG-TPNANC 218
             ||.|::|....:...| :..:||
Yeast   191 GVGNGKEGNISINSGSGNSSKSNC 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab3NP_001356961.1 Rab3 21..185 CDD:206657 85/163 (52%)
SEC4NP_116650.1 Rab8_Rab10_Rab13_like 18..183 CDD:206659 86/169 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47980
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.