DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab3 and YPT1

DIOPT Version :9

Sequence 1:NP_001356961.1 Gene:Rab3 / 36127 FlyBaseID:FBgn0005586 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_116615.1 Gene:YPT1 / 850505 SGDID:S000001856 Length:206 Species:Saccharomyces cerevisiae


Alignment Length:203 Identity:92/203 - (45%)
Similarity:137/203 - (67%) Gaps:5/203 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIWDTAG 79
            :..:||:||||:||||.|||:..|.|::||::|:.::||:|:|||:|||....|.||||||||||
Yeast     2 NSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAG 66

  Fly    80 QERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDMEDQRVI 144
            |||:||||::||||:.|.|::||||:::|||.|:.|:.:|..|:......:|||||||::|:||:
Yeast    67 QERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVV 131

  Fly   145 SFERGRQLADQLGVEFFETSAKENVNVKAVFERLVDIICDKMS-----ESLDADPTLVGGGQKGQ 204
            .::..::.||...:.|.||||.::.||:..|..:...|.:.||     |:............|||
Yeast   132 EYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNETTQKKEDKGNVNLKGQ 196

  Fly   205 RLTDQPQG 212
            .||:...|
Yeast   197 SLTNTGGG 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab3NP_001356961.1 Rab3 21..185 CDD:206657 81/163 (50%)
YPT1NP_116615.1 Rab1_Ypt1 7..172 CDD:206661 82/164 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.