DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab3 and RAB2B

DIOPT Version :10

Sequence 1:NP_523687.1 Gene:Rab3 / 36127 FlyBaseID:FBgn0005586 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_116235.2 Gene:RAB2B / 84932 HGNCID:20246 Length:216 Species:Homo sapiens


Alignment Length:173 Identity:69/173 - (39%)
Similarity:106/173 - (61%) Gaps:0/173 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIWDTAGQER 82
            :.|:||.:|||::.|||:..|.::.|..|......|:|::|..:.|....|::|||||||||||.
Human     3 YAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVNIDGKQIKLQIWDTAGQES 67

  Fly    83 YRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDMEDQRVISFE 147
            :|:||.:|||||.|.:|:||:|..::||.:..|:...:.:|..|..::|:|||.|:|.:|.:..|
Human    68 FRSITRSYYRGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGNKSDLESRRDVKRE 132

  Fly   148 RGRQLADQLGVEFFETSAKENVNVKAVFERLVDIICDKMSESL 190
            .|...|.:.|:.|.|||||...||:..|......|..|:.:.|
Human   133 EGEAFAREHGLIFMETSAKTACNVEEAFINTAKEIYRKIQQGL 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab3NP_523687.1 Rab3 21..185 CDD:206657 66/163 (40%)
RAB2BNP_116235.2 PLN03108 1..216 CDD:178655 69/173 (40%)
Switch 1. /evidence=ECO:0000250|UniProtKB:P61106 37..42 2/4 (50%)
Switch 2. /evidence=ECO:0000250|UniProtKB:P61106 63..72 5/8 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 189..216
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.