DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab3 and RAB11c

DIOPT Version :10

Sequence 1:NP_523687.1 Gene:Rab3 / 36127 FlyBaseID:FBgn0005586 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_172434.1 Gene:RAB11c / 837490 AraportID:AT1G09630 Length:217 Species:Arabidopsis thaliana


Alignment Length:208 Identity:78/208 - (37%)
Similarity:131/208 - (62%) Gaps:2/208 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIWDTAG 79
            |:.:||:||:::||:|.|||::.|.|:..:.|.....||:|::|..:|:....:.||.|||||||
plant     6 DEEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFCLESKSTIGVEFATRTLQVEGRTVKAQIWDTAG 70

  Fly    80 QERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDMEDQRVI 144
            |||||.||:||||||:|.:|:||||...:|.:|..|:.:::.::..|..::|:|||.|::..|.:
plant    71 QERYRAITSAYYRGALGALLVYDVTKPTTFENVSRWLKELRDHADSNIVIMLIGNKTDLKHLRAV 135

  Fly   145 SFERGRQLADQLGVEFFETSAKENVNVKAVFERLVDIICDKMS-ESLDADPTLVGGG-QKGQRLT 207
            :.|..:..|::.|:.|.||||.|.:||:..|:.::..:...:| :|:.:|.|..... ::||.:.
plant   136 ATEDAQSYAEKEGLSFIETSALEALNVEKAFQTILSEVYRIISKKSISSDQTTANANIKEGQTID 200

  Fly   208 DQPQGTPNANCNC 220
            .......||...|
plant   201 VAATSESNAKKPC 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab3NP_523687.1 Rab3 21..185 CDD:206657 66/163 (40%)
RAB11cNP_172434.1 P-loop containing Nucleoside Triphosphate Hydrolases 1..216 CDD:476819 78/208 (38%)

Return to query results.
Submit another query.