DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab3 and RABA2b

DIOPT Version :10

Sequence 1:NP_523687.1 Gene:Rab3 / 36127 FlyBaseID:FBgn0005586 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_172221.1 Gene:RABA2b / 837253 AraportID:AT1G07410 Length:214 Species:Arabidopsis thaliana


Alignment Length:190 Identity:77/190 - (40%)
Similarity:121/190 - (63%) Gaps:4/190 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIWDTAG 79
            |..:||:||:::||:|.|||::.|.|:..:.|.....||:|::|..:|:....|.||.|||||||
plant     6 DHEYDYLFKIVLIGDSGVGKSNILSRFTRNEFCLESKSTIGVEFATRTLQVEGKTVKAQIWDTAG 70

  Fly    80 QERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDMEDQRVI 144
            |||||.||:||||||:|.:|:||:|...:|.:|..|:.:::.::..|..:::.|||.|:...|.:
plant    71 QERYRAITSAYYRGAVGALLVYDITKRQTFENVLRWLRELRDHADSNIVIMMAGNKSDLNHLRSV 135

  Fly   145 SFERGRQLADQLGVEFFETSAKENVNVKAVFERLVD----IICDKMSESLDADPTLVGGG 200
            :.|.||.||::.|:.|.||||.|..|::..|:.::.    ||..|...:.:|...|.|.|
plant   136 ADEDGRSLAEKEGLSFLETSALEATNIEKAFQTILSEIYHIISKKALAAQEAAGNLPGQG 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab3NP_523687.1 Rab3 21..185 CDD:206657 69/167 (41%)
RABA2bNP_172221.1 PLN03110 1..214 CDD:178657 77/190 (41%)

Return to query results.
Submit another query.