DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab3 and RAB8C

DIOPT Version :9

Sequence 1:NP_001356961.1 Gene:Rab3 / 36127 FlyBaseID:FBgn0005586 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_195972.1 Gene:RAB8C / 831817 AraportID:AT5G03520 Length:216 Species:Arabidopsis thaliana


Alignment Length:198 Identity:101/198 - (51%)
Similarity:148/198 - (74%) Gaps:9/198 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ADQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIWDTA 78
            |..::||:.|||:||:|.|||:..|.|::||:||::|::|:|||||::||....||:||||||||
plant     8 ARSDYDYLIKLLLIGDSGVGKSCLLLRFSDDTFTTSFITTIGIDFKIRTVELDGKRIKLQIWDTA 72

  Fly    79 GQERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDM-EDQR 142
            ||||:|||||||||||||.:|:||||:|.|||::::|:..|:.::.||...||||||.|| |.:|
plant    73 GQERFRTITTAYYRGAMGILLVYDVTDESSFNNIRNWMKNIEQHASDNVNKILVGNKADMDESKR 137

  Fly   143 VISFERGRQLADQLGVEFFETSAKENVNVKAVFERLVDIICDKMSES-LDADPTLVGGGQKGQRL 206
            .:...:|:.|||:.|::|||||||.|:||:.||..:...|..:::|: ..|:|       :|.::
plant   138 AVPTAKGQALADEYGIKFFETSAKTNLNVENVFMSIAKDIKQRLTETDTKAEP-------QGIKI 195

  Fly   207 TDQ 209
            |.|
plant   196 TKQ 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab3NP_001356961.1 Rab3 21..185 CDD:206657 92/164 (56%)
RAB8CNP_195972.1 Rab8_Rab10_Rab13_like 13..180 CDD:206659 94/166 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47980
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.