DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab3 and RABA1e

DIOPT Version :10

Sequence 1:NP_523687.1 Gene:Rab3 / 36127 FlyBaseID:FBgn0005586 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_193578.1 Gene:RABA1e / 827574 AraportID:AT4G18430 Length:217 Species:Arabidopsis thaliana


Alignment Length:191 Identity:77/191 - (40%)
Similarity:125/191 - (65%) Gaps:3/191 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ADQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIWDTA 78
            ||.::||:|||::||:|.|||::.|.|:..:.|:....||:|::|..::|...:|.:|.|:||||
plant     6 ADDDYDYLFKLVLIGDSGVGKSNLLSRFTRNEFSIESKSTIGVEFATRSVHVDEKIIKAQLWDTA 70

  Fly    79 GQERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDMEDQRV 143
            ||||||.||:||||||:|.:|:||:|...:|.:|:.|:.:::.::..|..::|||||.|:...|.
plant    71 GQERYRAITSAYYRGAVGALLVYDITRHITFENVERWLKELRDHTDANVVIMLVGNKADLRHLRA 135

  Fly   144 ISFERGRQLADQLGVEFFETSAKENVNVKAVFERLVDIICDKMS-ESLD--ADPTLVGGGQ 201
            :..|..|..:::..:.|.||||.:..||:..|..::..|...|| ::||  .||..:..||
plant   136 VPTEEARSFSERENMFFMETSALDATNVEQAFTHVLTQIYRVMSRKALDGTGDPMSLPKGQ 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab3NP_523687.1 Rab3 21..185 CDD:206657 65/163 (40%)
RABA1eNP_193578.1 Rab11_like 11..175 CDD:206660 66/163 (40%)

Return to query results.
Submit another query.