DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab3 and RABA2c

DIOPT Version :10

Sequence 1:NP_523687.1 Gene:Rab3 / 36127 FlyBaseID:FBgn0005586 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_190267.1 Gene:RABA2c / 823836 AraportID:AT3G46830 Length:217 Species:Arabidopsis thaliana


Alignment Length:212 Identity:81/212 - (38%)
Similarity:129/212 - (60%) Gaps:8/212 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIWDTAG 79
            ||.:||:||:::||:|.|||::.|.|:..:.|.....||:|::|..:|.....|.:|.|||||||
plant     6 DQEYDYLFKIVLIGDSGVGKSNILSRFTRNEFCLESKSTIGVEFATRTTQVEGKTIKAQIWDTAG 70

  Fly    80 QERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDMEDQRVI 144
            |||||.||:||||||:|.:|:||:|...:|::|..|:.:::.::..|..:::.|||.|:...|.:
plant    71 QERYRAITSAYYRGAVGALLVYDITKRQTFDNVLRWLRELRDHADSNIVIMMAGNKSDLNHLRSV 135

  Fly   145 SFERGRQLADQLGVEFFETSAKENVNVKAVFERLV----DIICDK---MSESLDADPTLVGGGQK 202
            :.|.|:.||::.|:.|.||||.|..||:..|:.::    .||..|   ..|:..|:..:.|.|..
plant   136 AEEDGQSLAEKEGLSFLETSALEATNVEKAFQTILGEIYHIISKKALAAQEAAAANSAIPGQGTT 200

  Fly   203 GQRLTDQPQGTPNANCN 219
             ..:.|...|...|.|:
plant   201 -INVDDTSGGAKRACCS 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab3NP_523687.1 Rab3 21..185 CDD:206657 68/167 (41%)
RABA2cNP_190267.1 PLN03110 1..217 CDD:178657 81/212 (38%)

Return to query results.
Submit another query.