DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab3 and Rab13

DIOPT Version :9

Sequence 1:NP_001356961.1 Gene:Rab3 / 36127 FlyBaseID:FBgn0005586 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_112354.1 Gene:Rab13 / 81756 RGDID:620880 Length:203 Species:Rattus norvegicus


Alignment Length:196 Identity:94/196 - (47%)
Similarity:135/196 - (68%) Gaps:13/196 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIWDTAGQER 82
            :|::||||:||:|.||||..:.|:|:|:|.|.::||:|||||::||....||:|||:||||||||
  Rat     5 YDHLFKLLLIGDSGVGKTCLIIRFAEDNFNSTYISTIGIDFKIRTVEIEGKRIKLQVWDTAGQER 69

  Fly    83 YRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDMEDQRVISFE 147
            ::||||||||||||.||:||:|:|.||.::|:|:..||..:....:.:|:|||||||.:|.:..|
  Rat    70 FKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRKVQRE 134

  Fly   148 RGRQLADQLGVEFFETSAKENVNVKAVFERLVDIICDKMSESLDADPTLVGGGQKGQRLTDQPQG 212
            :..:||.:..:.|||||||.:|||            |:...||..|..|..||::... :.:|..
  Rat   135 QAERLAREHRIRFFETSAKSSVNV------------DEAFSSLARDILLKTGGRRSGN-SSKPSS 186

  Fly   213 T 213
            |
  Rat   187 T 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab3NP_001356961.1 Rab3 21..185 CDD:206657 84/163 (52%)
Rab13NP_112354.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 89/177 (50%)
Effector region. /evidence=ECO:0000250 37..45 4/7 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..203 4/16 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.