DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab3 and Rab1a

DIOPT Version :9

Sequence 1:NP_001356961.1 Gene:Rab3 / 36127 FlyBaseID:FBgn0005586 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_112352.2 Gene:Rab1a / 81754 RGDID:619736 Length:205 Species:Rattus norvegicus


Alignment Length:202 Identity:90/202 - (44%)
Similarity:136/202 - (67%) Gaps:6/202 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIWDTAGQER 82
            :||:||||:||:|.|||:..|.|:|||::|.:::||:|:|||::|:....|.:||||||||||||
  Rat     8 YDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQER 72

  Fly    83 YRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDMEDQRVISFE 147
            :||||::|||||.|.|::||||:::|||:|:.|:.:|..|:.:|...:|||||||:..::|:.:.
  Rat    73 FRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYT 137

  Fly   148 RGRQLADQLGVEFFETSAKENVNVKAVFERLVDIICDKMSESLDADPTLVGGGQKGQ-RLTDQPQ 211
            ..::.||.||:.|.|||||...||:..|..:...|..:|.....|     ||.:|.. ::...|.
  Rat   138 TAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATA-----GGAEKSNVKIQSTPV 197

  Fly   212 GTPNANC 218
            ......|
  Rat   198 KQSGGGC 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab3NP_001356961.1 Rab3 21..185 CDD:206657 81/163 (50%)
Rab1aNP_112352.2 Rab1_Ypt1 10..175 CDD:206661 82/164 (50%)
Effector region. /evidence=ECO:0000255 40..48 3/7 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..205 6/32 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.